Description
Target Information
Neurofilament consists of three major components: neurofilament light polypeptide (NF-L), mediate polypeptide (NF-M), and heavy polypeptide (NL-H). NF-L has 542 amino acid including a 91 aa N-terminal head, a 304 aa alpha -helical rod, and a 147 aa C-terminal tail. NF-L is first reported as a 69 kDa protein from by Hoffman and Lasek in 1975 analyzing the axonal transport paradigm, it plays an important role in the maintenance of neuronal caliber and possibly the pathogenesis of motor neuron diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Product Specifications
Species: Human
Synonyms: Neurofilament light polypeptide, 68 kDa neurofilament protein, neurofilament triplet L protein
Accession Number: P07196
Amino acid sequence
MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLEN
LDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYE
QEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEE
AAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD
Molecular weight: full length 61.6 kDa on SDS-PAGE
Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.
Form: Lyophilized
Shipping conditions: Ambient
Reviews
There are no reviews yet.