Description
Target Information
The gene encodes a protein that is part of the fibroblast growth factor (FGF) family. Members of the FGF family bind to heparin and exhibit extensive mitogenic and angiogenic activities. This protein is associated with various biological processes, including limb and nervous system development, wound healing, and tumor growth. The gene’s mRNA features multiple polyadenylation sites and can be alternatively translated from both non-AUG (CUG) and AUG initiation codons, producing five distinct isoforms with unique properties. Isoforms initiated by CUG are found in the nucleus and are responsible for intracrine effects, while the AUG-initiated form is primarily cytosolic and mediates paracrine and autocrine effects.
Product Specifications
Species: Human
Synonyms: ARVD; ARVD1; FLJ16571; LDS5; RNHF; TGFB3; TGFβ 3; TGF-β 3; TGF-β3; TGF-beta-3; transforming growth factor β-3; transforming growth factor, β 3.
Expression System: E coli
Fusion Tag: His tag
PALPEDGGSGAFPPGHFKDPKLLYCKNGGFFLRIHPDGRVDGTRDKSDPFIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLYAIKNVTDECFFFERLEENNYNTYRSRKYPSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (P143- S288)
Formulation: Lyophilized from a 0.2 μm-filtered solution in PBS.
Reconstitution: It is recommended to redissolve in 1x PBS.
Shipping conditions: Ambient
Storage & Stability: Recombinant N protein remains stable up to 3 years at -80oC from date of receipt. It will remain stable at 4oC for one week without losing any activity. Please avoid freeze-thaw cycles.
Reviews
There are no reviews yet.