Description
Target Information
Heregulin-β, also known as neuregulin-1 (NRG-1), belongs to the epidermal growth factor (EGF) family. It acts as a ligand for ErbB family receptor tyrosine kinases. NRG1 isoforms can signal in paracrine, autocrine, or juxtacrine modes. They play a crucial role in peripheral nervous system development and nerve repair, suggesting that NRG1 treatment could enhance functional recovery after injury. The NRG1 receptors are membrane-spanning receptor tyrosine kinases within the ErbB family, with EGF receptor (ErbB1) being the most prominent representative.
Product Specifications
Species: Human
Synonyms: Pro-neuregulin-1; Neuregulin-1 beta 1; NRG1-beta 1; HRG1-beta 1; EGF; NRG1; GGF; HGL; HRGA; NDF; SMDF.
Expression System: E coli
Fusion Tag: His tag
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE (S177-E241)
Formulation: Lyophilized from a 0.2 μm-filtered solution in PBS.
Reconstitution: It is recommended to redissolve in 1x PBS.
Shipping conditions: Ambient
Storage & Stability: Recombinant N protein remains stable up to 3 years at -80oC from date of receipt. It will remain stable at 4oC for one week without losing any activity. Please avoid freeze-thaw cycles.
Reviews
There are no reviews yet.